PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv7_169340_mcdu.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 489aa    MW: 51591.3 Da    PI: 10.0627
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv7_169340_mcdu.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.91.4e-15412464557
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                         +r+rr++kNRe+A rsR+RK+a++ eLe++v++L++eN++L+k+  e+ ++ +
  Bv7_169340_mcdu.t1 412 RRQRRMIKNRESAARSRARKQAYTMELEQEVQKLKEENQELRKKQAEIMEMQK 464
                         79*****************************************9999988865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF819958.63E-6250311No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-15406467No hitNo description
SMARTSM003385.1E-14408474IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.702410461IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.0E-11412461No hitNo description
CDDcd147073.95E-26412466No hitNo description
PfamPF001701.1E-13412464IPR004827Basic-leucine zipper domain
PROSITE patternPS000360415430IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MGSNTNINFS KNYGNEAAGD GGVGGSGRPP GSGLGSGNFS LARQLSVYSL TFDEFQNTLG  60
GMGKDFGSMN MDELLKNIWS AEETQCMAPG AGAGTAAVAA AAAVVGSGIQ EGGSSGGYLQ  120
RQGSLTLPRT LSQKTVDEVW KDIAKEFNGG KDGGGGSNVP QRQQTLGEIT LEEFLVRAGV  180
VREDTQVVGK PNNNNNTSAG AGIFGDFARP SNGNNGNTGF GINFQQPGRG VELMGNHIAE  240
TNHQMSLQAA NLPLNVNGVR TSQQQQQQQT PTQLSHSQQP QQQQQQQQQQ QQQQPLFPKQ  300
AAVSYASAMT LPNNAQLGNV GVRGGIMGLG DPGINSNMVQ SAAPQGGGGM GMVGLGGGGA  360
IGVPAGSPAA LSSDGLGRSN GDSSSVSPVP YMFNGGLRGR KGIHAVDKVV ERRQRRMIKN  420
RESAARSRAR KQAYTMELEQ EVQKLKEENQ ELRKKQAEIM EMQKNQVMEM INAQSGSRKK  480
LRRTQTGPW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1148155GGKDGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM9321270.0AM932127.1 Beta vulgaris subsp. vulgaris mRNA for ABA-responsive element binding protein 1 (areb1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001290004.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 5
RefseqXP_010685236.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9M7Q41e-129AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLB5QTD20.0B5QTD2_BETVU; ABA-responsive element binding protein 1
STRINGVIT_18s0001g10450.t011e-156(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.15e-97abscisic acid responsive elements-binding factor 2